PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AS_2603E68AF.3
Common NameNFYA-A3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 243aa    MW: 26503.6 Da    PI: 9.7031
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AS_2603E68AF.3genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA107.41.1e-33136192158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh+hA++R+Rg+gGrF
  Traes_4AS_2603E68AF.3 136 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHQHAMKRARGTGGRF 192
                            69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-38134195IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.328135195IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.0E-29137192IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-25138160IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860140160IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-25169192IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MRRKQNMQEN GTIMIQFGQQ VPNCESSASD SPQEVSGMSE GSFNEQNDQS GNRDGYTKSS  60
DEGKMMSALS LGNSEMAYTP PKPDRTHPFA ISYPYADPYY GGAVAAYGAH AIMHPQMVGM  120
VPSSRVPLPI EPAAAEEPIY VNAKQYHAIL RRRQLRAKLE AENKLVKSRK PYLHESRHQH  180
AMKRARGTGG RFLNAKEKSE ASGGGNASAR SGHAGVPPDG GMFSKHDHTL PSGDFHYRAR  240
GGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-24136199265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787500.0KM078750.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-A3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754217.11e-145PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ945M92e-41NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A0A7LUQ40.0A0A0A7LUQ4_WHEAT; CCAAT-binding transcription factor B
TrEMBLM8A1A41e-179M8A1A4_TRIUA; Nuclear transcription factor Y subunit A-9
STRINGMLOC_62730.11e-170(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-31nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Qu B, et al.
    A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input.
    Plant Physiol., 2015. 167(2): p. 411-23
    [PMID:25489021]